PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07451g01002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WOX
Protein Properties Length: 397aa    MW: 44827.6 Da    PI: 7.3894
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07451g01002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.63.8e-2280139357
                               --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                  Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                               +R+++t+eql++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  Niben101Scf07451g01002.1  80 SRWNPTPEQLQTLEELYRRgTRTPSAEQIQHITAQLrrygKIEGKNVFYWFQNHKARERQ 139
                               7*****************99**************************************97 PP

2Wus_type_Homeobox115.42.8e-3779141365
         Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                               ++RW+PtpeQ++ Leely++G+rtP++e+iq+ita+L++yGkie+kNVfyWFQN+kaRerqk+
  Niben101Scf07451g01002.1  79 SSRWNPTPEQLQTLEELYRRGTRTPSAEQIQHITAQLRRYGKIEGKNVFYWFQNHKARERQKR 141
                               79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.5E-577144IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.6E-980139IPR009057Homeodomain-like
PfamPF000466.9E-2080139IPR001356Homeobox domain
SuperFamilySSF466893.12E-1280145IPR009057Homeodomain-like
CDDcd000862.97E-681141No hitNo description
PROSITE profilePS5007111.25685140IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MWMMGYNDGG DFNMQDSFNG RKLRPLMPRV PHLPTANIST NPTCLRSIHG ENFIALNHHQ  60
LAMSEQNKRD FNTQQLVVSS RWNPTPEQLQ TLEELYRRGT RTPSAEQIQH ITAQLRRYGK  120
IEGKNVFYWF QNHKARERQK RRRQLESAVA GGAASAGGGG DDQSRSNCKP ENTERKESGA  180
NRTGFEIEQT KNWPSPTNCS TLAEKTVATT KAAAGVAECR VAAERWIPFD EREQRRSLLL  240
ADQRNATWQM MHLSCSPPTS TTPHHHIMNI NSSTAAISNT ISATTSPIIC SSNTPSTPRT  300
TMEPKQLFKT KDHLDIFIAP FRTDNRKHEN VENIVGDEGQ EESQTLELFP LRSSNDNNDD  360
NSFSEKDEVE ISGADANSNS NFSGSHYQFF EFLPLKN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009804164.10.0PREDICTED: WUSCHEL-related homeobox 1
RefseqXP_016437977.10.0PREDICTED: WUSCHEL-related homeobox 1-like
TrEMBLG0ZGT40.0G0ZGT4_NICSY; STENOFOLIA 1
STRINGPGSC0003DMT4000144641e-178(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46812342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.12e-61WUSCHEL related homeobox 1